| | |
The Monomer class provides abstractions to work with monomers. More...
| Header: | #include <MsXpS/libXpertMassCore/Monomer.hpp> |
| Inherits: | MsXpS::libXpertMassCore::PropListHolder |
| Monomer(MsXpS::libXpertMassCore::PolChemDefCstSPtr pol_chem_def_csp, const QDomElement &element, int version) | |
| Monomer(MsXpS::libXpertMassCore::PolChemDefCstSPtr pol_chem_def_csp = nullptr, const QString &name = QString(), const QString &code = QString(), const QString &formula_string = QString(), double mono = 0.0, double avg = 0.0) | |
| Monomer(const MsXpS::libXpertMassCore::Monomer &other) | |
| virtual | ~Monomer() |
| const MsXpS::libXpertMassCore::Monomer & | accountMasses(double &mono, double &avg, int times = 1) const |
| const MsXpS::libXpertMassCore::Monomer & | accountMasses(double *mono_p = nullptr, double *avg_p = nullptr, int times = 1) const |
| bool | calculateMasses(const MsXpS::libXpertMassCore::IsotopicDataCstSPtr &isotopic_data_csp, MsXpS::libXpertMassCore::Enums::ChemicalEntity monomer_chemical_entities = Enums::ChemicalEntity::NONE) |
| MsXpS::libXpertMassCore::Monomer & | calculateMasses(bool &ok, const MsXpS::libXpertMassCore::IsotopicDataCstSPtr &isotopic_data_csp, MsXpS::libXpertMassCore::Enums::ChemicalEntity monomer_chemical_entities = Enums::ChemicalEntity::NONE) |
| bool | calculateMasses(const MsXpS::libXpertMassCore::IsotopicDataCstSPtr &isotopic_data_csp, double &mono, double &avg, MsXpS::libXpertMassCore::Enums::ChemicalEntity monomer_chemical_entities = Enums::ChemicalEntity::NONE) const |
| bool | checkCodeSyntax(int code_length = -1) const |
| void | clear() |
| int | countModifsByName(const QString &modif_name) |
| QString | formatXmlMnmElement(int offset, const QString &indent = Utils::xmlIndentationToken) const |
| QString | formatXmlMonomerElement(int offset, const QString &indent = Utils::xmlIndentationToken) const |
| std::vector<QString> | getAllModifUuids() const |
| QString | getCode() const |
| MsXpS::libXpertMassCore::MonomerSPtr | getFromPolChemDefByCode() const |
| MsXpS::libXpertMassCore::MonomerSPtr | getFromPolChemDefByName() const |
| double | getMass(MsXpS::libXpertMassCore::Enums::MassType mass_type) const |
| MsXpS::libXpertMassCore::ModifSPtr | getModifForUuid(const QString &uuid) const |
| const std::vector<MsXpS::libXpertMassCore::ModifSPtr> & | getModifsCstRef() const |
| QString | getName() const |
| const MsXpS::libXpertMassCore::PolChemDefCstSPtr & | getPolChemDefCstSPtr() const |
| QString | getUuidForModif(const MsXpS::libXpertMassCore::ModifSPtr &modif_sp) const |
| bool | hasModif(const MsXpS::libXpertMassCore::ModifSPtr &modif_sp) const |
| bool | hasUuid(const MsXpS::libXpertMassCore::ModifSPtr &modif_sp) const |
| MsXpS::libXpertMassCore::Enums::PolChemDefEntityStatus | isKnownByCodeInPolChemDef() const |
| MsXpS::libXpertMassCore::Enums::PolChemDefEntityStatus | isKnownByNameInPolChemDef() const |
| bool | isModified() const |
| bool | isValid() const |
| std::vector<QString> | modifNamesInOrder() const |
| QString | modify(const MsXpS::libXpertMassCore::Modif &modif, bool override, MsXpS::libXpertMassCore::ErrorList *error_list_p) |
| QString | modify(const QString &modif_name, bool override, MsXpS::libXpertMassCore::ErrorList *error_list_p) |
| bool | renderXmlMnmElement(const QDomElement &element, int version) |
| bool | renderXmlMonomerElement(const QDomElement &element, int version) |
| void | setCode(const QString &code) |
| void | setFormula(const QString &formula_string) |
| void | setName(const QString &name) |
| void | setPolChemDefCstSPtr(MsXpS::libXpertMassCore::PolChemDefCstSPtr &pol_chem_def_csp) |
| QString | storeModif(const MsXpS::libXpertMassCore::Modif &modif) |
| QString | storeModif(const MsXpS::libXpertMassCore::ModifSPtr &modif_sp) |
| QString | toString() const |
| bool | unmodify() |
| bool | unmodify(const QString &uuid) |
| bool | validate(MsXpS::libXpertMassCore::ErrorList *error_list_p) const |
| bool | operator!=(const MsXpS::libXpertMassCore::Monomer &other) const |
| MsXpS::libXpertMassCore::Monomer & | operator=(const MsXpS::libXpertMassCore::Monomer &other) |
| bool | operator==(const MsXpS::libXpertMassCore::Monomer &other) const |
| QString | m_code |
| QString | m_formula |
| bool | m_isValid |
| std::vector<MsXpS::libXpertMassCore::ModifSPtr> | m_modifs |
| QString | m_name |
| MsXpS::libXpertMassCore::PolChemDefCstSPtr | mcsp_polChemDef |
| MonomerCstRPtr | |
| MonomerCstSPtr | |
| MonomerCstUPtr | |
| MonomerCstWPtr | |
| MonomerRPtr | |
| MonomerSPtr | |
| MonomerUPtr | |
| MonomerWPtr | |
| UuidMonomerCstWPtrPair |
In libmass, a momomer is an entity that is part of a polymer chemistry definition. A monomer models a chemical entity that is part of a polymer.
In protein chemistry, that would be a residue, that is, an amino-acid that has been polymerized into a residue chain (that is, a protein, or a peptide). The chemical reaction that polymerizez an amino acid into an elongating protein structure is a condensation, with loss of H2O from the amino acid to actually lead to a what is called a residue of a monomer, or for short a residue.
Note: The monomer, that is partly defined by its formula, has the formula of the residue, not of the amino acid. This is always true, whatever the polymer chemistry definition at hand: protein, saccharide, nucleic acid.
Constructs a monomer starting from an XML <mnm> element according to version and using the reference polymer chemistry definition pol_chem_def_csp.
This is the current format:
<mnm> <name>Glycine</name> <code>G</code> <formula>C2H3N1O1</formula> </mnm>
Constructs a monomer with its member data set to name, code, formula_string, The pol_chem_def_csp and both masses mono and avg.
The member m_isValid validity status is set to the result of this Monomer validation.
Constructs a monomer as a copy of other.
[virtual noexcept] Monomer::~Monomer()Destroys the monomer.
Increases mono and avg by the corresponding member masses first compounded by times.
Returns true.
Increases mono_p and avg_p by the corresponding member masses first compounded by times.
Returns true.
Calculates this monomer's monoisotopic and avg masses.
The calculation is performed by computing the masses of this monomer's formula, accounting or not the entities described by monomer_chemical_entities.
The reference data for the computations are accessed at isotopic_data_csp.
Returns true if the calculations were successful, false otherwise.
See also Formula::accountMasses().
Calculates this monomer's monoisotopic and avg masses.
The calculation is performed by computing the masses of this monomer's formula.
If monomer_chemical_entities & MONOMER_CHEMENT_MODIF is true, then the masses are updated to account for the mass of modifications.
Set ok to true if the calculations were successful, false otherwise.
Returns this object.
See also Formula::accountMasses().
Calculates this monomer's monoisotopic and avg masses and sets the results to mono and avg.
The calculation is performed by computing the masses of this monomer's formula, accounting the chemical entities defined by monomer_chemical_entities.
The calculations are performed using reference data in isotopic_data_csp.
Returns true if the calculations were successful, false otherwise.
See also Formula::accountMasses().
Checks the code's syntactic validity.
If code_length is not -1, then that length is used for the check. Otherwise, the length from the polymer chemistry definition (if available) is used.
The monomer code is verified and has to verify these criteria:
Returns true if the code syntax checked successfully, false otherwise.
See also validate().
Clears all the data of the Monomer instance.
Returns the count of modifications by name modif_name in this monomer.
Formats this monomer's data as a string suitable to be used as an XML element in the polymer chemistry definition.
The typical monomer element that is generated in this function looks like this:
<monomers> <mnm> <name>Glycine</name> <code>G</code> <formula>C2H3N1O1</formula> </mnm>
The formatting of the XML element takes into account offset and indent by prepending the string with offset * indent character substring.
indent defaults to two spaces.
Returns a dynamically allocated string that needs to be freed after use.
Formats a string suitable to be used as an XML element in a polymer sequence file.
The typical monomer element that is generated in this function looks like this:
<monomer> <code>S</code> <prop> <name>MODIF</name> <data>Phosphorylation</data> </prop> <prop> <name>COMMENT</name> <data>Phosphorylation is only partial</data> </prop> </monomer>
The formatting of the XML element takes into account offset and indent by prepending the string with offset * indent character substring.
indent defaults to two spaces.
Returns a string.
Returns a container of QString instances that correspond to the UUID strings that identify all the Modif instances involved in this Monomer.
If no Modif is found, an empty container is returned.
Returns the code
Returns the Monomer instance from the polymer chemistry definition registered in this instance.
The key to search the Monomer is this instance's member code.
If there is no PolChemDef available, nullptr is returned.
If no Monomer instance is found by this instance's code, nullptr is returned.
Returns the Monomer instance from the polymer chemistry definition registered in this instance.
The key to search the Monomer is this instance's member name.
If there is no PolChemDef available, nullptr is returned.
If no Monomer instance is found by this instance's name, nullptr is returned.
Returns the mass of the type defined by mass_type.
Returns the Monomer instance pointer in the member container that is associated to the uuid Uuid string.
If no such Monomer instance pointer is found, nullptr is returned.
Returns the container of Modif instances that modify this Monomer.
Returns the name.
Returns the polymer chemistry definition.
Returns the UUID string identifying modif_sp in the member container.
If no such Modif is found, an empty string is returned.
Returns true if modif_sp was found in the member container of Modif instances, false otherwise.
Returns true if modif_sp was found in the member container of Uuid-Modif pairs, false otherwise.
Returns the status of this Monomer instance the polymer chemistry definition registered in this instance.
The key to search the Monomer is this instance's member code.
If there is no PolChemDef available, Enums::PolChemDefEntityStatus::POL_CHEM_DEF_NOT_AVAILABLE is returned.
If no Monomer instance is found by this instance's code, Enums::PolChemDefEntityStatus::ENTITY_NOT_KNOWN is returned, otherwise Enums::PolChemDefEntityStatus::ENTITY_KNOWN is returned.
Returns the status of this Monomer instance the polymer chemistry definition registered in this instance.
The key to search the Monomer is this instance's member name.
If there is no PolChemDef available, Enums::PolChemDefEntityStatus::POL_CHEM_DEF_NOT_AVAILABLE is returned.
If no Monomer instance is found by this instance's name, Enums::PolChemDefEntityStatus::ENTITY_NOT_KNOWN is returned, otherwise Enums::PolChemDefEntityStatus::ENTITY_KNOWN is returned.
Returns true if this monomer has at least one modification, false otherwise.
Returns the validity status of this Monomer.
See also validate().
Returns the list of Modif names in the same order as the Modif instances are stored in the member container.
Modifies this monomer using modif.
These two verifications that are done:
The two restrictions above can be overridden by setting override to true.
If errors are encountered, these are reported as strings in error_list_p.
Returns a string with the Uuid of the allocated Modif instance.
Modifies this monomer using modif_name.
modif_name is used to find a Modif instance in the polymer chemistry definition.
If such a Modif is found, it is used to modify this Monomer.
Returns a string with the Uuid of the allocated Modif instance.
Parses the monomer XML element specifically for version.
Parses the monomer XML element passed as argument and for each encountered data will set the data to this monomer (this is called XML rendering).The parsing is delegated to a function that is specific for for version of the polymer chemistry definition.
The XML element is found in the polymer chemistry definition and has the following form:
<monomers> <mnm> <name>Glycine</name> <code>G</code> <formula>C2H3N1O1</formula> </mnm> <mnm> <name>Alanine</name> <code>A</code> <formula>C3H5N1O1</formula> </mnm>
After setting all the data, this monomer calculates it masses and validates itself. If any of these steps fails, the error is reported by returning false.
See also validate().
Parses into this monomer the XML monomer element passed as argument.
The XML element comes from a polymer sequence file, where the monomer is singled out (not in a sequence string) because it might be modified, like this:
<monomer> <code>S</code> <mdf> <name>Phosphorylation</name> <formula>H1O3P1</formula> <targets>*</targets> <maxcount>1</maxcount> </mdf> </monomer> <codes>GRKASGSSPTSPINADKVENEDAFLEEVAEEKPHVKPYFTKTILDMEVVEGSAARFDCKIEGYPDPEVM</codes> <monomer> <code>W</code> <mdf> <name>Oxidation</name> <formula>O1</formula> <targets>*</targets> <maxcount>1</maxcount> </mdf> </monomer> <codes>YKDDQPVKESRHFQIDYDEEGNCSLTISEVCGDDDAKYTCKAVNSLGEATCTAELLVETMGKEGEGEGEGEEDEEEEEE</codes>
version indicates the format version of this XML element.
As soon as the monomer code is known, while parsing the element, the corresponding monomer is searched in the list of monomers in the member polymer chemistry definition (mcsp_polChemDef). Then, the found monomer is copied into this monomer so that both monomers are identical, effectively initializing this monomer to the monomer described by the element.
If the element contains one or more mdf modifications, these modifications are allocated as Modif's and validated. If these modifications validate successfully, they are appended to this monomer's list of modifications.
Returns true if initialization of his monomer with the contents of element succeeded, false otherwise.
See also formatXmlMonomerElement(int offset, const QString &indent).
Sets the code to code
Sets the formula to formula_string.
Sets the name.
Sets the polymer chemistry definition to pol_chem_def_csp.
Stores the Modif instance modif in the member container.
The modif is used to craft a ModifSPtr that is stored.
Returns the Uuid string associated to the stored Modif.
Stores the Modif instance modif_sp pointer in the member container.
The modif_sp is stored as is, without duplication.
Returns the Uuid string associated to the stored Modif.
Returns a text string representing this Monomer instance.
Removes all the modification from this monomer.
Returns true if at least one Modif instance was removed, false if this Monomer instance was not modified.
Removes from this monomer the Modif instance tagged using the Uuid uuid string.
Returns true if the unmodification was actually performed, false otherwise.
Returns true if this monomer is valid, false otherwise.
Validation of the monomer occurs if:
If errors are encountered, describing message are stored in error_list_p.
See also checkCodeSyntax().
Returns true if this monomer and other differ, false otherwise.
Returns the negated result of operator==(other).
Assigns other's member data to this monomer.
The copy is deep, in particular with the mpa_modifList being copied.
Returns a reference to this monomer.
Returns true if this monomer and other are identical, false otherwise.
The comparison involves also the comparison of the Modif objects in mpa_modifList.
This variable holds the code of the monomer, like K for lysine, A for adenine.
This variable holds the formula of the monomer.
This variable holds the validity status of the Monomer.
This variable holds the container of Modif instances that are involved in the modification of this Monomer.
The Modif pointers stored in the m_modifs member are ModifSPtr pointers.
This variable holds the name of the monomer, like Lysine, Adenine.
This variable holds the polymer chemistry definition that is the context in which the Monomer instance exists.
Synonym for const Monomer *.
[alias] MonomerCstSPtrSynonym for std::shared_ptr<const Monomer>.
Synonym for std::unique_ptr<const Monomer>.
Synonym for std::weak_ptr<const Monomer>.
Synonym for Monomer *.
[alias] MonomerSPtrSynonym for std::shared_ptr<Monomer>.
Synonym for std::unique_ptr<Monomer>.
Synonym for std::weak_ptr<Monomer>.
[alias] UuidMonomerCstWPtrPairSynonym for std::pair<QString, MonomerCstWPtr> items.
These pairs are used to store a unique identifier (Uuid) string related to a std::shared_ptr<const Monomer> type. This kind of pair is used in a container in the CrossLink class. The fact that the std::shared_ptr is converted to a std::weak_ptr is interesting because the item in the pair will not increase the reference count.